mCRAMP (mouse)

mCRAMP (mouse)

Catalog Number:
P004516659LIF
Mfr. No.:
PEPTIDE-AM-040
Price:
  • Size:
    1mg
    Quantity:
    Add to Cart:
      • Overview
        • Sole murine cathelicidin and homologue of human LL 37.
          mCRAMP (mouse) or mouse calethicidin-related antimicrobial peptide, is the sole murine cathelicidin and intestinal homologue of human LL-37. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon where it exhibits antimicrobial activity against enteric pathogens and it is established as a component of the innate antimicrobial defense in mice. mCRAMP deficiency has been linked to alcoholic liver disease (ALD) in mice and it also produces viral-induced responses in mouse cells. mCRAMP synergises wirh rifamycin for intracellular killing of mycobacteria.

          Please contact us for availability.

          Please contact us at for specific academic pricing.

      • Properties
        • Categories
          Antimicrobial Peptides
          Alternative Name
          Mouse calethicidin related antimicrobial peptide
          Molecular Formula
          C178H302N50O46
          Molecular Weight
          3878.7
          Appearance
          Freeze dried solid
          Purity
          >95% by HPLC
          Solubility
          Soluble in dilute acid and physiological buffers
          Other Properties
          Sequence: H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH,GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
          Storage
          Store dry, frozen and desiccated

          * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

    Note: If you don't receive our verification email, do the following:

    • Confirm that you entered your email address correctly.
    • Check if the email is in your spam or junk folder.
    • Or you may contact us at .
    Copyright © Amerigo Scientific. All rights reserved.