Melittin, C-terminal cysteine labelled

Melittin, C-terminal cysteine labelled

Catalog Number:
P004516661LIF
Mfr. No.:
PEPTIDE-AM-210
Price:
  • Size:
    1mg
    Quantity:
    Add to Cart:
      • Overview
        • Synthetic melittin with an extra cysteine residue at the C terminal.
          Melittin, C-terminal cysteine labelled is synthetic melittin with an extra cysteine residue at the C terminal. Melittin is a cationic, haemolytic component of honey bee venom used to study cell and liposome lysis. Melittin is a positively charged, amphipathic 26-amino-acid peptide that associates with the phospholipids of membrane bilayers, causing cell death by forming transmembrane toroidal pores at nanomolar concentrations.
          Melittin, C-terminal cysteine labelled, can be labelled with any maleimide linked tag to generate fluorescent or biotinylated derivatives.

          Please contact us for availability.

          Please contact us at for specific academic pricing.

      • Properties
        • Categories
          Antimicrobial Peptides
          Molecular Formula
          C134H234N40O32S
          Molecular Weight
          2949.63
          Appearance
          Freeze dried solid
          Purity
          >95% by HPLC
          Solubility
          Soluble in dilute acid and physiological buffers
          Other Properties
          Sequence: H-Gly-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-Thr-Thr-Gly-Leu-Pro-Ala-Leu-Ile-Ser-Trp-Ile-Lys-Arg-Lys-Arg-Gln-Gln-Cys-NH2,GIGAVLKVLTTGLPALISWIKRKRQQC-NH2
          Modification: C-terminal amide
          Storage
          Store desiccated, frozen and in the dark

          * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

    We Also Recommend

    OP-145

    $403

    Note: If you don't receive our verification email, do the following:

    • Confirm that you entered your email address correctly.
    • Check if the email is in your spam or junk folder.
    • Or you may contact us at .
    Copyright © Amerigo Scientific. All rights reserved.