Name: TAT-HuR-HNS3
Price: 397.00 USD

- Overview
  - HuR-PARP1 interaction blocker.
    TAT-HuR-HNS3 is a cell penetrating peptide derived from the human antigen R – nucleocytoplasmic shuttling sequence (HuR-HNS) domain. HuR, also known as embryonic lethal abnormal vision-like 1 (ELAVL1) is a well characterized RNA-binding protein that increases the stability of short lived mRNAs which encode proinflammatory mediators. HuR employs its HNS domain to interact with poly(ADP-ribose) polymerase 1 (PARP1), and intervention by TAT-HuR-HNS3 interrupts this interaction, resulting in lower poly-ADP-ribosylation and decreased cytoplasmic distribution of HuR. TAT-HuR-HNS3 also blocks HuR dimerization and promotes argonaute 2-based miRNA induced silencing complex binding. TAT-HuR-HNS3 lowers the mRNA stability of proinﬂammatory mediators in TNF-? treated epithelial cells and macrophages, and decreases TNF-? induced inflammatory responses in animal lung models.
    
    Please contact us for availability.
    
    Please contact us at for specific academic pricing.
- Properties
  - Categories
    
    Cell Penetrating Peptides
    
    Molecular Formula
    
    C151H257N59O46S2
    
    Molecular Weight
    
    3696.9
    
    Appearance
    
    Freeze dried solid
    
    Purity
    
    >95% by HPLC
    
    Solubility
    
    Soluble in water
    
    Other Properties
    
    Sequence: H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Ser-Pro-Met-Gly-Val-Asp-His-Met-Ser-Gly-Leu-Ser-Gly-Val-Asn-Val-Pro-Gly-Asn-Ala-Ser-Ser-Gly-OH,YGRKKRRQRRRSPMGVDHMSGLSGVNVPGNASSG
    
    Storage
    
    Store dry, frozen and in the dark
    
    * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

TAT-HuR-HNS3

TAT-HuR-HNS3

We Also Recommend

Tat-NTS peptide

TAT-QFNP12

tatM2NX