Recombinant Bovine FGF2 Growth Factor

- Overview
  - Recombinant Bovine FGF2 is a serum-free sustainable growth factor that fulfills the needs of FGF2 requirements in cell culture across a variety of land-dwelling and aquatic species.
    
    Produced in a bioreactor-free, green-certified lab, our purified Recombinant Bovine FGF2 is demonstrated to be a high-performing, bioactive, drop-in replacement for commercially available recombinant FGF2 in driving proliferation of cells that express FGF-receptors.
    
    - SPR analyses confirm FGF receptor binding at a dissociation constant (Kd) that is comparable to literature (<5nM).
    - Confirmed to drive proliferation of cells expressing FGF receptors via the activation of MAPK/ERK pathways.
    - Purity of over 95% verified by SDS-PAGE.
    - Quality and safety test results show the protein is negative for mycoplasma contamination and below safety threshold (less than 1 EU/ug) for endotoxin.
    
    Comes as lyophilized powder. Research use only.
    
    Please contact us at for specific academic pricing.
- Properties
  - Protein Name
    
    Basic Fibroblast Growth Factor, bFGF, FGF2
    
    Source
    
    Drosophila melanogaster
    
    Type
    
    Recombinant Proteins
    
    Purification
    
    >95% purity as measured by SDS PAGE
    
    Formulation
    
    Purified protein stored in 50 mM Tris pH 8, 150 mM NaCl, and 2 mM EDTA.
    
    Storage
    
    Store lyophilized protein at 2-8°C. Centrifuge vial prior to opening
    
    Concentration
    
    Lyophilized from 160.0 μg/mL. Recommended use at 0.01 - 0.25 ug/mL in cell culture medium for your unique cell line.
    
    Sequence
    
    MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
    
    Endotoxin
    
    N/A
    
    Activity
    
    Determined by FGF2R2/3 pathway activation of MEK/ERK via phosphorylation (ELISA and Western blot analysis). Tested in C2C12 immortalized myoblast cells at 0.0078 - 1.0 μg/mL in media for cell culture. Tested in HeLa cells at 0.1 μg/mL in media for cell culture.
    
    * For research use only. Not for diagnostic or therapeutic use.
- Reference
  - A simple and robust serum-free media for the proliferation of muscle cells. Skrivergaard S, Feveile Young J, Sahebekhtiari N, Semper C, Venkatesan M, Savchenko A, et al. Food Res Int. 2023 Jun;113194.
    Satellite cells sourced from bull calves and dairy cows differs in proliferative and myogenic capacity – Implications for cultivated meat. Skrivergaard S, Krøyer Rasmussen M, Sahebekhtiari N, Feveile Young J, Therkildsen M. Food Res Int. 2023 Nov;173:113217.

MSDS

Recombinant Bovine FGF2 Growth Factor

Recombinant Bovine FGF2 Growth Factor

We Also Recommend

Recombinant Human FGF2 Growth Factor

Recombinant Human Prolactin, Fc tag