Recombinant Bovine FGF2 Growth Factor

Recombinant Bovine FGF2 Growth Factor

Catalog Number:
P001389210FUT
Mfr. No.:
FGF2-221P
Price:
$291
  • Size:
    Quantity:
    Add to Cart:
      • Overview
        • Recombinant Bovine FGF2 is a serum-free sustainable growth factor that fulfills the needs of FGF2 requirements in cell culture across a variety of land-dwelling and aquatic species.

          Produced in a bioreactor-free, green-certified lab, our purified Recombinant Bovine FGF2 is demonstrated to be a high-performing, bioactive, drop-in replacement for commercially available recombinant FGF2 in driving proliferation of cells that express FGF-receptors.

          - SPR analyses confirm FGF receptor binding at a dissociation constant (Kd) that is comparable to literature (<5nM).
          - Confirmed to drive proliferation of cells expressing FGF receptors via the activation of MAPK/ERK pathways.
          - Purity of over 95% verified by SDS-PAGE.
          - Quality and safety test results show the protein is negative for mycoplasma contamination and below safety threshold (less than 1 EU/ug) for endotoxin.

          Comes as lyophilized powder. Research use only.

          Please contact us at for specific academic pricing.

      • Properties
        • Protein Name
          Basic Fibroblast Growth Factor, bFGF, FGF2
          Source
          Drosophila melanogaster
          Type
          Recombinant Proteins
          Purification
          >95% purity as measured by SDS PAGE
          Formulation
          Purified protein stored in 50 mM Tris pH 8, 150 mM NaCl, and 2 mM EDTA.
          Storage
          Store lyophilized protein at 2-8°C. Centrifuge vial prior to opening
          Concentration
          Lyophilized from 160.0 μg/mL. Recommended use at 0.01 - 0.25 ug/mL in cell culture medium for your unique cell line.
          Sequence
          MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
          Endotoxin
          N/A
          Activity
          Determined by FGF2R2/3 pathway activation of MEK/ERK via phosphorylation (ELISA and Western blot analysis). Tested in C2C12 immortalized myoblast cells at 0.0078 - 1.0 μg/mL in media for cell culture. Tested in HeLa cells at 0.1 μg/mL in media for cell culture.

          * For research use only. Not for diagnostic or therapeutic use.

      • Reference

    Note: If you don't receive our verification email, do the following:

    Copyright © Amerigo Scientific. All rights reserved.