Hooke Kits™ for EAE Induction in C57BL/6 Mice

Hooke Kits™ for EAE Induction in C57BL/6 Mice

Catalog Number:
IVRK578954HOO
Mfr. No.:
EIK-0110; EIK-0111
Price:
$757
  • Size:
    Quantity:
    Add to Cart:
      • Overview
        • Emulsion supplied in pre-filled syringes, ready to use.

          •Consistently induces EAE in female C57BL/6 mice
          EAE develops in 90 to 100% of untreated mice. In most mice disease onset occurs between 9 and 16 days after immunization. Most mice will reach a maximum score of 3.0 to 3.5.

          Each lot is tested in vivo and individually adjusted to ensure consistent disease induction. On Day 0, MOG35-55/CFA or MOG1-125/CFA emulsion and pertussis toxin are injected. On Day 1, a second dose of pertussis toxin is injected.

          •Eliminates tedious preparation of emulsions
          Properly prepared emulsions are critical for reliable induction of many autoimmune disease models. Our emulsions are carefully made and pre-filled into syringes, ready to use, to reduce time needed to set up experiments.

          •Saves time and mice in testing individual reagents
          Lot-to-lot reagent variations can cause dramatic changes in severity of induced autoimmune disease. The consistent potency of pre-characterized Hooke Kits™ eliminates time-consuming testing.

          •Reduces your mouse facility's exposure to pathogen contamination
          Pre-filled syringes are prepared under aseptic conditions and delivered in sterilized plastic bags for easy disinfection before introduction into your mouse facility.

          Experimental autoimmune encephalomyelitis (EAE) is the model most commonly used to study efficacy of potential drugs for treatment of multiple sclerosis (MS).

          Because of its many similarities to MS, EAE is used to study pathogenesis of autoimmunity, CNS inflammation, demyelination, cell trafficking and tolerance induction.

          EAE is characterized by paralysis (in some models the paralysis is relapsing-remitting), CNS inflammation and demyelination. EAE is initiated by myelin-specific CD4+ T cells, with glia cells (microglia and astrocytes), B cells, macrophages, NK cells, and dendritic cells all playing important roles in disease development.

          Kit selection
          MOG35-55 antigen is recommended for study of onset and development of EAE and testing efficacy of potential therapeutics. The induced immune response will be directed against a single epitope. This antigen will consistently induce T cell responses, but will not consistently induce B cell responses, and as a result there will be no consistent anti-MOG35-55 antibody production. EAE severity does not correlate with antibody production. EAE induced with this emulsion is not B cell dependent.

          MOG1-125 antigen induces a response directed against multiple epitopes and will induce consistent anti-MOG1-125 antibody production. EAE induced with this emulsion is B cell dependent. Our EIK-0111 kit is therefore recommended for testing therapeutics which specifically target B cells

          The Hooke Kit™ MOG35-55/CFA Emulsion PTX is supplied as a PTX emulsion in syringes for C57BL/6 mice aged 9 to 13 weeks.

          The Hooke Kit™ MOG1-125/CFA Emulsion PTX is supplied as a PTX emulsion in syringes for C57BL/6 mice aged 9 to 13 weeks.

          Please contact us at for specific academic pricing.

      • Properties
        • Other Properties
          Each kit provides sufficient reagents for 10 mice.
          EIK-0110 antigen is myelin oligodendrocyte glycoprotein 35-55 (MOG35-55) rat, mouse, sequence MEVGWYRSPFSRVVHLYRNGK.
          EIK-0111 antigen is human recombinant myelin oligodendrocyte glycoprotein 1-125 (MOG1-125), sequence MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGG
          FTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH.
          3 syringes pre-filled with 0.7 mL antigen/CFA emulsion, containing ~1 mg MOG35-55/mL emulsion, ~0.5 mg MOG1-125/mL emulsion, and ~1–5 mg killed Mycobacterium tuberculosis H37Ra/mL emulsion.
          1 vial containing 3–6 µg pertussis toxin (PTX) in glycerol buffer; the amount is adjusted by lot for consistent EAE induction (see protocol).
          1 data sheet: recommended experimental protocol and typical results.
          Storage
          Stable for 20 days when stored at 2–4 °C.
          Do not freeze.

          * For Research Use Only.

      • Reference