Name: Tat-beclin 1
Price: 298.00 USD

- Overview
  - Autophagy inducing peptide.
    Tat-beclin 1 is a cell permeable peptide derived from the domain of the autophagy protein beclin 1 that interacts with HIV-1 Nef, attached to the HIV-1 Tat protein transduction domain. Tat-beclin 1 activates beclin1 by competing against its negative regulator GAPR-1/glioma pathogenesis-related protein-2 (GLIPR2). Tat-beclin 1 suppresses the accumulation of htt103Q, a polyglutamine expansion protein derived from human mutant Huntingtin protein, and can inhibit the replication of pathogens including HIV-1 and West Nile virus in vitro and in vivo.
    
    Please contact us at for specific academic pricing.
- Properties
  - Categories
    
    Cell Penetrating Peptides
    
    Alternative Name
    
    Tat-BECN1, Beclin-1 Activator I, beclin 1 peptide
    
    Molecular Formula
    
    C164H251N57O45
    
    Molecular Weight
    
    3741.15
    
    Appearance
    
    Freeze dried solid
    
    Purity
    
    >95% by HPLC
    
    Solubility
    
    Soluble in water
    
    Other Properties
    
    Sequence: H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH,YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
    
    Storage
    
    Store dry, frozen and in the dark
    
    * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

Tat-beclin 1

Tat-beclin 1

We Also Recommend

Tat-braftide

TAT-CBD3

TAT-CBD3A6K