Tat-beclin 1

Tat-beclin 1

Catalog Number:
P004516707LIF
Mfr. No.:
PEPTIDE-PP-200
Price:
  • Size:
    1mg
    Quantity:
    Add to Cart:
      • Overview
        • Autophagy inducing peptide.
          Tat-beclin 1 is a cell permeable peptide derived from the domain of the autophagy protein beclin 1 that interacts with HIV-1 Nef, attached to the HIV-1 Tat protein transduction domain. Tat-beclin 1 activates beclin1 by competing against its negative regulator GAPR-1/glioma pathogenesis-related protein-2 (GLIPR2). Tat-beclin 1 suppresses the accumulation of htt103Q, a polyglutamine expansion protein derived from human mutant Huntingtin protein, and can inhibit the replication of pathogens including HIV-1 and West Nile virus in vitro and in vivo.

          Please contact us at for specific academic pricing.

      • Properties
        • Categories
          Cell Penetrating Peptides
          Alternative Name
          Tat-BECN1, Beclin-1 Activator I, beclin 1 peptide
          Molecular Formula
          C164H251N57O45
          Molecular Weight
          3741.15
          Appearance
          Freeze dried solid
          Purity
          >95% by HPLC
          Solubility
          Soluble in water
          Other Properties
          Sequence: H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH,YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
          Storage
          Store dry, frozen and in the dark

          * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

    Note: If you don't receive our verification email, do the following:

    • Confirm that you entered your email address correctly.
    • Check if the email is in your spam or junk folder.
    • Or you may contact us at .
    Copyright © Amerigo Scientific. All rights reserved.