LL 37 (human)

LL 37 (human)

Catalog Number:
P004516654LIF
Mfr. No.:
PEPTIDE-AM-001
Price:
$305
  • Size:
    1mg
    Quantity:
    Add to Cart:
      • Overview
        • Host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide.
          LL 37 (human) is a 37 amino acid host defence peptide derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), which has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis. In addition to its antimicrobial properties, LL 37 (human) modulates numerous pathways in autoimmune and inflammatory diseases and has a role in the pathogenesis of lupus, RA and atherosclerosis. As a binding partner to A42, LL 37 (human) expression impacts initiation and progression of Alzheimer’s disease. LL 37 also has a significant role in human cancer, inducing tumourigenic effects in cancers of the ovary, lung, breast, prostate, pancreas, and also in malignant melanoma.

          Please contact us for availability.

          Please contact us at for specific academic pricing.

      • Properties
        • Categories
          Antimicrobial Peptides
          Alternative Name
          Ropocamptide, hCAP 18, Cathelicidin LL 37, LL-37, cathelicidin LL 37 (human)
          Molecular Formula
          C205H340N60O53
          Molecular Weight
          4493.3
          Appearance
          Freeze dried solid
          Purity
          >95% by HPLC
          Solubility
          Soluble in water
          Other Properties
          Sequence: H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH,[LL-37, 37 aa]
          Modification: C terminal amide
          Storage
          Store dry, dark and frozen

          * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

    We Also Recommend

    Note: If you don't receive our verification email, do the following:

    Copyright © Amerigo Scientific. All rights reserved.