Name: LL 37 (human) biotinylated, pegylated
Price: 409.00 USD

- Overview
  - N-terminally biotinylated version of the host defence peptide LL 37.
    LL 37 (human) biotinylated, pegylated is the N-terminally biotinylated version of the host defence peptide LL 37 with a biotin group attached via a pegylated chain, PEG(4). The presence of the biotin tag allows numerous biochemical and microbiological applications. LL 37, derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis.
    
    Please contact us for availability.
    
    Please contact us at for specific academic pricing.
- Properties
  - Categories
    
    Biotin Labelled Peptides
    
    Molecular Formula
    
    C226H376N64O59S
    
    Molecular Weight
    
    4967
    
    Appearance
    
    Freeze dried solid
    
    Purity
    
    >95% by HPLC
    
    Solubility
    
    Soluble in water
    
    Other Properties
    
    Sequence: Biotin-[PEG(4)]-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH,Biotin-[PEG(4)]-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
    Modification: Biotinylation and pegylation on the N terminus
    
    Storage
    
    Store frozen, dessicated and in the dark
    
    * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

LL 37 (human) biotinylated, pegylated

LL 37 (human) biotinylated, pegylated

We Also Recommend

(Arg)9

pFYN peptide

SRC-1 (676-700), biotinylated