LL 37 (human) biotinylated, pegylated

LL 37 (human) biotinylated, pegylated

Catalog Number:
P004516684LIF
Mfr. No.:
PEPTIDE-AM-200
Price:
  • Size:
    1mg
    Quantity:
    Add to Cart:
      • Overview
        • N-terminally biotinylated version of the host defence peptide LL 37.
          LL 37 (human) biotinylated, pegylated is the N-terminally biotinylated version of the host defence peptide LL 37 with a biotin group attached via a pegylated chain, PEG(4). The presence of the biotin tag allows numerous biochemical and microbiological applications. LL 37, derived from the C-terminal of human cathelicidin antimicrobial peptide (CAMP, hCAP18), has antimicrobial, antitumour, antiviral and immunomodulatory properties and also has physiological functions in chemotaxis, promotion of wound closure, and angiogenesis.

          Please contact us for availability.

          Please contact us at for specific academic pricing.

      • Properties
        • Categories
          Biotin Labelled Peptides
          Molecular Formula
          C226H376N64O59S
          Molecular Weight
          4967
          Appearance
          Freeze dried solid
          Purity
          >95% by HPLC
          Solubility
          Soluble in water
          Other Properties
          Sequence: Biotin-[PEG(4)]-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH,Biotin-[PEG(4)][LL-37, 37 aa]
          Modification: Biotinylation and pegylation on the N terminus
          Storage
          Store frozen, dessicated and in the dark

          * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

    Note: If you don't receive our verification email, do the following:

    • Confirm that you entered your email address correctly.
    • Check if the email is in your spam or junk folder.
    • Or you may contact us at .
    Copyright © Amerigo Scientific. All rights reserved.