Name: GLP-1 (1-37) (human, rat)
Price: 412.00 USD

- Overview
  - Pancreatic hormone from posttranslational proglucagon proteolysis.
    GLP-1 (1-37) is a pancreatic hormone resulting from post-translational proteolysis of proglucagon. GLP-1(1-37) does not affect food intake in rats and does not enhance pancreatic insulin. It is secreted by the small intestine in response to nutrient ingestion with wide-ranging effects on glucose metabolism, including stimulation of insulin release, inhibition of glucagon secretion, reduction of gastric emptying and satiety. The insulinotropic actions of GLP-1 depend on ambient glucose concentrations, making it highly relevant in type 2 diabetes. GLP-1 (1-37) also has an important role in the cardiovascular system.
    
    Please contact us for availability.
    
    Please contact us at for specific academic pricing.
- Properties
  - Categories
    
    Peptides
    
    Alternative Name
    
    GLP-1 (1-37)
    
    Molecular Formula
    
    C186H275N51O59
    
    Molecular Weight
    
    4169.5
    
    Appearance
    
    Freeze dried solid
    
    Purity
    
    >95% by HPLC
    
    Solubility
    
    Soluble in dilute acid
    
    Other Properties
    
    Sequence: H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH,HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
    
    Storage
    
    Store dry, frozen and desiccated
    
    * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

We Also Recommend

GLP-1 (7-36) amide (human, rat)

$331

GLP-1 (7-37)

$331

GLP-1 (9-36) amide

$767

GLP-1 (9-36) amide

$331