Name: GLP-1 (7-36) amide (human, rat)
Price: 331.00 USD

- Overview
  - Insulinotropic incretin peptide hormone.
    GLP-1 (7-36) amide is a potent insulinotropic incretin peptide hormone produced as a result of proteolytic post-translational modification of proglucagon in L-cells of the lower intestine. GLP-1 (7-36) amide displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells with a Kd of 204 pM. GLP-1 (7-36) amide stimulates insulin gene transcription and secretion in pancreatic ?-cells, displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.
    
    Please contact us for availability.
    
    Please contact us at for specific academic pricing.
- Properties
  - Categories
    
    Peptides
    
    Molecular Formula
    
    C149H226N40O45
    
    Molecular Weight
    
    3297.7
    
    Appearance
    
    Freeze dried solid
    
    Purity
    
    >95% by HPLC
    
    Solubility
    
    Soluble in dilute acid
    
    Other Properties
    
    Sequence: H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2,HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
    Modification: C terminal amide
    
    Storage
    
    Store dry, frozen and desiccated
    
    * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

We Also Recommend

GLP-1 (7-37)

$331

GLP-1 (9-36) amide

$767

GLP-1 (9-36) amide

$331

Glucagon (1-29)

$298