Name: GIP (human)
Price: 397.00 USD

- Overview
  - Stimulates insulin release.
    GIP (Gastric Inhibitory Polypeptide) is derived from a 153-amino acid proprotein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. GIP is released by the K cells of the duodenum and jejunum in response to food intake and while it is weak inhibitor of gastric acid secretion, its main role is to stimulate insulin release. Type 2 diabetics are not responsive to GIP and have lower levels of GIP secretion after a meal when compared to non-diabetics. In mice, absence of GIP receptors correlates with resistance to obesity.
    
    Please contact us for availability.
    
    Please contact us at for specific academic pricing.
- Properties
  - Categories
    
    Peptides
    
    Alternative Name
    
    Gastric Inhibitory Polypeptide, Glucose dependent insulinotropic polypeptide
    
    Molecular Formula
    
    C226H338N60O66S
    
    Molecular Weight
    
    4983.6
    
    Appearance
    
    Freeze dried solid
    
    Purity
    
    >95% by HPLC
    
    Solubility
    
    Soluble in dilute acid
    
    Other Properties
    
    Sequence: H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH,YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
    
    Storage
    
    Store dessicated, dark and frozen
    
    * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

GIP (human)

GIP (human)

We Also Recommend

GIP (porcine)

GIP-1 (3-42) (human)

GIP_HUMAN[22-51]