Name: GIP (porcine)
Price: 298.00 USD

- Overview
  - Stimulates insulin secretion.
    GIP is a member of a family of structurally related hormones that includes secretin, glucagon, and vasoactive intestinal peptide. GIP (human) differs from GIP (porcine) at residues 18 and 34. GIP is secreted from specific endocrine cells (K-cells) in the epithelium of the upper part of small intestine after ingestion of food. Once released, GIP is subjected to NH2-terminal degradation by dipeptidyl peptidase-IV (DPP-IV), yielding GIP (3-42) as the primary metabolite which acts as a GIP receptor antagonist.
    
    Please contact us for availability.
    
    Please contact us at for specific academic pricing.
- Properties
  - Categories
    
    Peptides
    
    Alternative Name
    
    Glucose dependent insulinotropic polypeptide (porcine), Gastric inhibitory peptide (porcine)
    
    Molecular Formula
    
    C225H342N60O66S
    
    Molecular Weight
    
    4975.62
    
    Appearance
    
    Freeze dried solid
    
    Purity
    
    >95% by HPLC
    
    Solubility
    
    Soluble in water
    
    Other Properties
    
    Sequence: H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH,YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
    
    Storage
    
    Store dry, frozen and in the dark
    
    * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

GIP (porcine)

GIP (porcine)

We Also Recommend

GIP-1 (3-42) (human)

GIP_HUMAN[22-51]

GLP-1 (1-36) amide