Name: CRF (human, rat)
Price: 381.00 USD

- Overview
  - Endogenous CRF receptor agonist.
    CRF (human, rat) is an endogenous peptide derived from a 196-amino acid preprohormone which acts as an agonist for CRF receptors, with Ki values of 11, 44 and 38 nM for hCRF1, rCRF2a and mCRF2b respectively. CRF (human, rat) is a major regulator of the hypothalamic pituitary adrenal axis response and is a stress-related neuropeptide whose dysregulation has been associated with depression. Increased CRF (human, rat) production is also associated with Alzheimer’s disease.
    
    Please contact us for availability.
    
    Please contact us at for specific academic pricing.
- Properties
  - Categories
    
    Peptides
    
    Alternative Name
    
    Corticotropin releasing factor (human, rat), Corticotropin releasing hormone, CRH
    
    Molecular Formula
    
    C208H344N60O63S2
    
    Molecular Weight
    
    4757.51
    
    Appearance
    
    Freeze dried solid
    
    Purity
    
    >95% by HPLC
    
    Solubility
    
    Soluble to 1.10 mg/ml in water
    
    Other Properties
    
    Sequence: H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2,SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
    Modification: C-terminal amide
    
    Storage
    
    Store dry, frozen and in the dark
    
    * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

CRF (human, rat)

CRF (human, rat)

We Also Recommend

CXCL8 (54-72)

CXCL8 (54-72) scrambled control

CXCL9(74-103)