Name: Cecropin A
Price: Inquiry

- Overview
  - Broad spectrum insect antimicrobial.
    Cecropin A (CeA) is a natural linear cationic ?-helical antimicrobial peptide (AMP) originally identified in moths (Hyalophora cecropia) and later in pig intestine. Cecropin A contains a strongly cationic region at its N-terminus and a large hydrophobic tail at its C-terminus, which allow its interaction with the microbial membrane, and then cell lysis by pore formation. Cecropin A has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens. Cecropins constitute a main part of the innate immune system of insects.
    
    Please contact us for availability.
    
    Please contact us at for specific academic pricing.
- Properties
  - Categories
    
    Antimicrobial Peptides
    
    Alternative Name
    
    CeA
    
    Molecular Formula
    
    C184H313N53O46
    
    Molecular Weight
    
    4003.8
    
    Appearance
    
    Freeze dried solid
    
    Purity
    
    >95% by HPLC
    
    Solubility
    
    Soluble in dilute acid
    
    Other Properties
    
    Sequence: H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2,KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
    Modification: C terminal amide
    
    Storage
    
    Store desiccated, frozen and in the dark
    
    * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

We Also Recommend

Cecropin B

$285

Cecropin A

Cecropin A

We Also Recommend

Cecropin B

Cecropin B

Cecropin B

Cys-Pexiganan

D-K6L9