sfTSLP (60 aa peptide)

sfTSLP (60 aa peptide)

Catalog Number:
P004516676LIF
Mfr. No.:
PEPTIDE-AB-020
Price:
$423
  • Size:
    0.1mg
    Quantity:
    Add to Cart:
      • Overview
        • Antimicrobial, the 60 amino acid sequence of the short form of thymic stromal lymphopoietin (sfTSLP).
          sfTSLP (60 aa peptide) is an antibacterial peptide derived as the 60 amino acid sequence of the short form of thymic stromal lymphopoietin (sfTSLP). Thymic stromal lymphopoietin (TSLP) is a cytokine first identified in a mouse model as a B-cell growth factor produced by a thymic stromal cell line. Two transcript variants of human TSLP are described: a long form of TSLP (lfTSLP, variant 1) and an alternative, short form (sfTSLP, variant 2). The sequence of sfTSLP has two potential starting methionines that can give rise to either a 63 or a 60 aa peptide. Compared with lfTSLP, sfTSLP possesses stronger antibacterial activity and appears to act as an antimicrobial peptide in the oral cavity and on the skin to create a defense barrier that aids in the control microbes.

          Please contact us for availability.

          Please contact us at for specific academic pricing.

      • Properties
        • Categories
          Antimicrobial Peptides
          Molecular Formula
          C310H520N98O83S4
          Molecular Weight
          7076.41
          Appearance
          Freeze dried solid
          Purity
          >95% by HPLC
          Other Properties
          Sequence: H-Met-Lys-Thr-Lys-Ala-Ala-Leu-Ala-Ile-Trp-Cys-Pro-Gly-Tyr-Ser-Glu-Thr-Gln-Ile-Asn-Ala-Thr-Gln-Ala-Met-Lys-Lys-Arg-Arg-Lys-Arg-Lys-Val-Thr-Thr-Asn-Lys-Cys-Leu-Glu-Gln-Val-Ser-Gln-Leu-Gln-Gly-Leu-Trp-Arg-Arg-Phe-Asn-Arg-Pro-Leu-Leu-Lys-Gln-Gln-OH,MKTKAALAIWCPGYSETQINATQAMKK RRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
          Storage
          Store dry, frozen and in the dark

          * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

    We Also Recommend

    Tiger17

    $339

    Note: If you don't receive our verification email, do the following:

    Copyright © Amerigo Scientific. All rights reserved.