-
-
Overview
-
SDF1 (CXCL12) labelled 15N and 13C for NMR, LPS-Free
SDF-1α for Mass Spectrometry is the 8 kDa protein labelled with isotope 15N and 13C .
This protein is suitable for NMR studies.
This product corresponds to the human sequence and is produced in E.coli.
SDF-1α we provide is the natural protein, with no tags or additional amino acids.
It has the sequence:
["MKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK"]
Molecular Mass: Stromal Cell-Derived Factor 1α (SDF-1α, CXCL12) consists of 69 amino acid residues and has a calculated molecular mass of approximately 8 kDA
Purity: The purified protein is >95% homogeneous (electrophoresis). It contains no nucleic acids.
Endotoxin Level: The purified protein is free from LPS (Pierce™ Chromogenic Endotoxin Quant Kit, <0.1 EU/mL). The product contains <0.006% v/v of Triton X-114 due to LPS removal procedure. The remaining traces of Triton X-114 can be removed upon request.
Buffer & Reconstitution: the lyophilized protein once reconstituted with distilled water will be dissolved in a solution of DPBS without Ca and Mg.
Storage: 2-8°C when lyophilized. The protein once reconstituted with water can be stored frozen (-20°C). Avoid repeated freezing and thawing.Please contact us at for specific academic pricing.
-
- Properties
- Reference
-
Overview