Peptide YY (human)

Peptide YY (human)

Catalog Number:
P004516899LIF
Mfr. No.:
PEPTIDE-GH-110
Price:
  • Size:
    1mg
    Quantity:
    Add to Cart:
      • Overview
        • Neuropeptide Y agonist that binds all subtypes with similar affinity.
          Peptide YY, also known as PYY and PYY (1-36) is a 36-amino acid peptide that is synthesized and released from enteroendocrine cells. Peptide YY was initially isolated from porcine intestinal extracts and named peptide YY due to the presence of tyrosine residues at the C- and N-termini. Peptide YY belongs to the family of peptides that includes neuropeptide Y (NPY) and pancreatic polypeptide (PP) and all three peptides mediate their effects via G-protein-coupled receptors. Peptide YY binds to all Y-receptor subtypes with similar affinity. Peptide YY in humans has a role in food ingestion, gut motility and insulin secretion, and also suppresses appetite and has been associated with obesity and type 2 diabetes.

          Please contact us for availability.

          Please contact us at for specific academic pricing.

      • Properties
        • Categories
          Peptides
          Alternative Name
          PYY, PYY (1-36)
          Molecular Formula
          C194H295N55O57
          Molecular Weight
          4049.5
          Appearance
          Freeze dried solid
          Purity
          >95% by HPLC
          Solubility
          Soluble in dilute acid
          Other Properties
          Sequence: H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2,YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
          Modification: C terminal amide
          Storage
          Store desiccated, frozen and in the dark

          * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

    Note: If you don't receive our verification email, do the following:

    • Confirm that you entered your email address correctly.
    • Check if the email is in your spam or junk folder.
    • Or you may contact us at .
    Copyright © Amerigo Scientific. All rights reserved.