Name: Peptide YY (human)
Price: 385.00 USD

- Overview
  - Neuropeptide Y agonist that binds all subtypes with similar affinity.
    Peptide YY, also known as PYY and PYY (1-36) is a 36-amino acid peptide that is synthesized and released from enteroendocrine cells. Peptide YY was initially isolated from porcine intestinal extracts and named peptide YY due to the presence of tyrosine residues at the C- and N-termini. Peptide YY belongs to the family of peptides that includes neuropeptide Y (NPY) and pancreatic polypeptide (PP) and all three peptides mediate their effects via G-protein-coupled receptors. Peptide YY binds to all Y-receptor subtypes with similar affinity. Peptide YY in humans has a role in food ingestion, gut motility and insulin secretion, and also suppresses appetite and has been associated with obesity and type 2 diabetes.
    
    Please contact us for availability.
    
    Please contact us at for specific academic pricing.
- Properties
  - Categories
    
    Peptides
    
    Alternative Name
    
    PYY, PYY (1-36)
    
    Molecular Formula
    
    C194H295N55O57
    
    Molecular Weight
    
    4049.5
    
    Appearance
    
    Freeze dried solid
    
    Purity
    
    >95% by HPLC
    
    Solubility
    
    Soluble in dilute acid
    
    Other Properties
    
    Sequence: H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2,YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
    Modification: C terminal amide
    
    Storage
    
    Store desiccated, frozen and in the dark
    
    * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

We Also Recommend

Peptide5

$301

PKA inhibitor (6-22) amide

$222

PKI (5-24)

$240