Pancreatic polypeptide (human)

Pancreatic polypeptide (human)

Catalog Number:
P004516890LIF
Mfr. No.:
PEPTIDE-NY-030
Price:
  • Size:
    1mg
    Quantity:
    Add to Cart:
      • Overview
        • Endogenous agonist for the human NPY Y4 receptor.
          Pancreatic polypeptide (human) is an endogenous high affinity agonist for the human NPY Y4 receptor, with a Ki of 0.056 nM. Pancreatic polypeptide (human) is produced and secreted by PP cells of the pancreas which are primarily located in the Islets of Langerhans and is a member of the family of peptides that includes peptide YY (PYY) and neuropeptide Y (NPY). Pancreatic polypeptide (human) is rapidly released after a meal and in humans remains elevated for 4-6 hours, with the vagus nerve being the major stimulator. Pancreatic polypeptide (human) causes a sustained decrease in both appetite and food intake.

          Please contact us for availability.

          Please contact us at for specific academic pricing.

      • Properties
        • Categories
          Peptides
          Alternative Name
          Pancreatic polypeptide, PP
          Molecular Formula
          C185H287N53O54S2
          Molecular Weight
          4181.7
          Appearance
          Freeze dried solid
          Purity
          >95%
          Solubility
          Soluble to 0.70 mg/ml in water
          Other Properties
          Sequence: H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2,APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
          Modification: C-terminal amide
          Storage
          Store dry, frozen and in the dark

          * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

    Note: If you don't receive our verification email, do the following:

    • Confirm that you entered your email address correctly.
    • Check if the email is in your spam or junk folder.
    • Or you may contact us at .
    Copyright © Amerigo Scientific. All rights reserved.