Name: Pancreatic polypeptide (human)
Price: 385.00 USD

- Overview
  - Endogenous agonist for the human NPY Y4 receptor.
    Pancreatic polypeptide (human) is an endogenous high affinity agonist for the human NPY Y4 receptor, with a Ki of 0.056 nM. Pancreatic polypeptide (human) is produced and secreted by PP cells of the pancreas which are primarily located in the Islets of Langerhans and is a member of the family of peptides that includes peptide YY (PYY) and neuropeptide Y (NPY). Pancreatic polypeptide (human) is rapidly released after a meal and in humans remains elevated for 4-6 hours, with the vagus nerve being the major stimulator. Pancreatic polypeptide (human) causes a sustained decrease in both appetite and food intake.
    
    Please contact us for availability.
    
    Please contact us at for specific academic pricing.
- Properties
  - Categories
    
    Peptides
    
    Alternative Name
    
    Pancreatic polypeptide, PP
    
    Molecular Formula
    
    C185H287N53O54S2
    
    Molecular Weight
    
    4181.7
    
    Appearance
    
    Freeze dried solid
    
    Purity
    
    >95%
    
    Solubility
    
    Soluble to 0.70 mg/ml in water
    
    Other Properties
    
    Sequence: H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2,APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
    Modification: C-terminal amide
    
    Storage
    
    Store dry, frozen and in the dark
    
    * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

We Also Recommend

Parathyroid hormone (1 – 13) (human)

$259

Parathyroid hormone (1-34) (human)

$258

Parathyroid hormone (1-34) (human)

$301

Parathyroid hormone (1-34) (rat)

$334