Name: Bay 55-9837
Price: 381.00 USD

- Overview
  - Selective VPAC2 agonist.
    Bay 55-9837 is a selective vasoactive intestinal peptide receptor 2 (VPAC2 receptor) agonist, binding to VPAC2 with a Kd of 0.65 nmol/l and having greater than 100-fold selectivity over VPAC1. BAY 55-9837 stimulates glucose-dependent insulin secretion in isolated pancreatic islets, increases insulin synthesis in rat islets, and causes a dose-dependent increase in plasma insulin levels in fasted rats. BAY 55-9837 raises survival motor neuron (SMN) protein levels through pharmacological modulation of the SMN2 gene and ameliorates disease phenotype in severe spinal muscular atrophy mouse models.
    
    Please contact us for availability.
    
    Please contact us at for specific academic pricing.
- Properties
  - Categories
    
    Peptides
    
    Molecular Formula
    
    C167H270N52O46
    
    Molecular Weight
    
    3742.29
    
    Appearance
    
    Freeze dried solid
    
    Purity
    
    >95% by HPLC
    
    Solubility
    
    Soluble to 2 mg/ml in water
    
    Other Properties
    
    Sequence: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2,HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2
    Modification: C-terminal amide
    
    Storage
    
    Store dry, frozen and in the dark
    
    * Please note: this product can only be supplied to registered research and development facilities, and may be used for in vitro research use only, not for administration to humans or animals.

Bay 55-9837

Bay 55-9837

We Also Recommend

Bid BH3

BigLEN (mouse)

Bim BH3